PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015900980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family bHLH
Protein Properties Length: 223aa    MW: 25721.4 Da    PI: 6.8115
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015900980.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH29.61.3e-093784655
                    HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
             HLH  6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                     ++E++RRd+++  +++L +llP+   ++++ l+  +   +A++YIk+L+
  XP_015900980.1 37 RIIEKNRRDQMKILYSKLYSLLPQH--TSKEPLTLPDQIDEAINYIKNLE 84
                    689*********************7..37777***************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000832.14E-53188No hitNo description
SuperFamilySSF474591.12E-1031101IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088811.6363183IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.9E-836101IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000109.8E-63784IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGLFLVNTSE NNKHTSNDFS IMDQKASQFP SIKIERRIIE KNRRDQMKIL YSKLYSLLPQ  60
HTSKEPLTLP DQIDEAINYI KNLEMRLKNY EGKKERLLGR KRLHTSLNFD STAGKQRPPK  120
IEIHEMGSVL EVILISGSEN QFVFYEVIRI IQDEGADIIN AKFSVSGETI YHVINAQIGD  180
SMFIFGAAKI TERLKRFVSG SSSDVEPQPE LWDFEIHPGT WEF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13945EKNRRDQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015900980.11e-165PREDICTED: transcription factor bHLH36-like
TrEMBLW9RA846e-85W9RA84_9R
STRINGGLYMA12G12880.12e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.11e-32bHLH family protein